-----Dad,lookatthebuilding.Itisonfire.

-----Call119____________mobilephonerightnow

A、in
B、by
C、on
D、with
查看答案
正确答案:

B

答案解析:

暂无解析

上一题
你可能感兴趣的试题

1. A European spacecraft took off today to spearhead the search for another "Earth" among the stars.

2. The Corot space telescope blasted off aboard a Russian Soyuz rocket from the Baikonur cosmodrome in Kazakhstan shortly after 2.20pm.

3. Corot, short for convection rotation and planetary transits, is the first instrument capable of finding small rocky planets beyond the solar system. Any such planet situated in the right orbit stands a good chance of having liquid water on its surface, and quite possibly life, although a leading scientist involved in the project said it was unlikely to find "any little green men".

4. Developed by the French space agency, CNES, and partnered by the European Space Agency (ESA), Austria, Belgium, Germany, Brazil and Spain, Corot will monitor around 120,000 stars with its 27cm telescope from a polar orbit 514 miles above the Earth. Over two and a half years, it will focus on five to six different areas of the sky, measuring the brightness of about 10,000 stars every 512 seconds.

5. "At the present moment we are hoping to find out more about the nature of planets around stars which are potential habitats. We are looking at habitable planets, not inhabited planets. We are not going to find any little green men," Professor Ian Roxburgh, an ESA scientist who has been involved with Corot since its inception, told the BBC Radio 4 Today programme.

6. Prof Roxburgh said it was hoped Corot would find "rocky planets that could develop an atmosphere and, if they are the right distance from their parent star, they could have water".

7. To search for planets, the telescope will look for the dimming of starlight caused when an object passes in front of a star, known as a "transit". Although it will take more sophisticated space telescopes planned in the next 10 years to confirm the presence of an Earth-like planet with oxygen and liquid water, Corot will let scientists know where to point their lenses.

8. Measurements of minute changes in brightness will enable scientists to detect giant Jupiter-like gas planets as well as small rocky ones. It is the rocky planets - that could be no bigger than about twice the size of the Earth - which will cause the most excitement. Scientists expect to find between 10 and 40 of these smaller planets.

9. Corot will also probe into stellar interiors by studying the acoustic waves that ripple across the surface of stars, a technique called "asteroseismology".

10. The nature of the ripples allows astronomers to calculate a star’s precise mass, age and chemical composition.

11. "A planet passing in front of a star can be detected by the fall in light from that star. Small oscillations of the star also produce changes in the light emitted, which reveal what the star is made of and how they are structured internally. This data will provide a major boost to our understanding of how stars form and evolve," Prof Roxburgh said.

12. Since the discovery in 1995 of the first "exoplanet" - a planet orbiting a star other than the Sun - more than 200 others have been found by ground-based observatories.

13. Until now the usual method of finding exoplanets has been to detect the "wobble" their gravity imparts on parent stars. But only giant gaseous planets bigger than Jupiter can be found this way, and they are unlikely to harbour life.

14. In the 2010s, ESA plans to launch Darwin, a fleet of four or five interlinked space telescopes that will not only spot small rocky planets, but analyse their atmospheres for signs of biological activity.

15. At around the same time, the US space agency, Nasa, will launch Terrestrial Planet Finder, another space telescope designed to locate Earth-like planets.

Choose the appropriate letter from A-D for question 1.

1. Corot is an instrument which

(A) can help to search for certain planets

(B) is used to find planets in the orbit

(C) can locate planets with human beings

(D) can spot any planets with water.

Do the following statements agree with the information given in the reading passage? For questions 2-5 write

TRUE if the statement agrees with the information

FALSE if the statement contraicts the information

NOT GIVEN if there is no information on this in the passage

2. Scientists are trying to find out about the planets that can be inhabited.

3. BBC Radio 4 recently focuses on the broadcasting of Corot.

4. Passing objects might cause a fall in light.

5. Corot can tell whether there is another Earth-like planet.

Based on your reading of the passage, complete the sentences below with words taken from the passage. Use NO MORE THAN THREE WORDS for each answer.

With measurements, scientists will be able to search for some gaseous and rocky planets. They will be extremely excited if they can discover some small 6. __________, the expected number of which could be up to 7. __________ .

Corot will enable scientists to study the 8. __________ of stars. In this way, a star’s mass, age and chemical composition can be calculated.

According to Prof Roxburgh, changes in light can be caused by passing planets or star 9. __________. The related statistics can gain us a better 10. __________ of the star formation and evolvement.

Observatories have found many exoplanets, which are 11. __________ other stars than the Sun. The common way used in finding exoplanets can only detect huge gas planets, which do not 12. ___________ .

With the launching of Darwin, astronomers will be able to analyse whether those rocky planets have 13. __________ for life.

Rogue theory of smell gets a boost

1.A controversial theory of how we smell, which claims that our fine sense of odour depends on quantum mechanics, has been given the thumbs up by a team of physicists.

2.Calculations by researchers at University College London (UCL) show that the idea that we smell odour molecules by sensing their molecular vibrations makes sense in terms of the physics involved.

3.That's still some way from proving that the theory, proposed in the mid-1990s by biophysicist Luca Turin, is correct.But it should make other scientists take the idea more seriously.

4."This is a big step forward," says Turin, who has now set up his own perfume company Flexitral in Virginia.He says that since he published his theory, "it has been ignored rather than criticized."

5.Most scientists have assumed that our sense of smell depends on receptors in the nose detecting the shape of incoming molecules, which triggers a signal to the brain.This molecular 'lock and key' process is thought to lie behind a wide range of the body's detection systems: it is how some parts of the immune system recognise invaders, for example, and how the tongue recognizes some tastes.

6.But Turin argued that smell doesn't seem to fit this picture very well.Molecules that look almost identical can smell very different — such as alcohols, which smell like spirits, and thiols, which smell like rotten eggs.And molecules with very different structures can smell similar.Most strikingly, some molecules can smell different — to animals, if not necessarily to humans — simply because they contain different isotopes (atoms that are chemically identical but have a different mass).

7.Turin's explanation for these smelly facts invokes the idea that the smell signal in olfactory receptor proteins is triggered not by an odour molecule's shape, but by its vibrations, which can enourage an electron to jump between two parts of the receptor in a quantum-mechanical process called tunnelling.This electron movement could initiate the smell signal being sent to the brain.

8.This would explain why isotopes can smell different: their vibration frequencies are changed if the atoms are heavier.Turin's mechanism, says Marshall Stoneham of the UCL team, is more like swipe-card identification than a key fitting a lock.

9.Vibration-assisted electron tunnelling can undoubtedly occur — it is used in an experimental technique for measuring molecular vibrations."The question is whether this is possible in the nose," says Stoneham's colleague, Andrew Horsfield.

10.Stoneham says that when he first heard about Turin's idea, while Turin was himself based at UCL, "I didn't believe it".But, he adds, "because it was an interesting idea, I thought I should prove it couldn't work.I did some simple calculations, and only then began to feel Luca could be right." Now Stoneham and his co-workers have done the job more thoroughly, in a paper soon to be published in Physical Review Letters.

11.The UCL team calculated the rates of electron hopping in a nose receptor that has an odorant molecule bound to it.This rate depends on various properties of the biomolecular system that are not known, but the researchers could estimate these parameters based on typical values for molecules of this sort.

12.The key issue is whether the hopping rate with the odorant in place is significantly greater than that without it.The calculations show that it is — which means that odour identification in this way seems theoretically possible.

13.But Horsfield stresses that that's different from a proof of Turin's idea."So far things look plausible, but we need proper experimental verification.We're beginning to think about what experiments could be performed."

14.Meanwhile, Turin is pressing ahead with his hypothesis."At Flexitral we have been designing odorants exclusively on the basis of their computed vibrations," he says."Our success rate at odorant discovery is two orders of magnitude better than the competition." At the very least, he is putting his money where his nose is.

Questions 5-9

Complete the sentences below with words from the passage.Use NO MORE THAN THREE WORDS for each answer.

5.The hypothesis that we smell by sensing the molecular vibration was made by ______.

6.Turin's company is based in ______.

7.Most scientists believed that our nose works in the same way as our ______.

8.Different isotopes can smell different when ______ weigh differently.

9.According to Audrew Horsfield, it is still to be proved that ______ could really occur in human nose.

1There'sadimmerswitchinsidethesunthatcausesitsbrightnesstoriseandfallontimescalesofaround100,000years-exactlythesameperiodasbetweeniceagesonEarth.Sosaysaphysicistwhohascreatedacomputermodelofourstar'score.

2RobertEhrlichofGeorgeMasonUniversityinFairfax,Virginia,modelledtheeffectoftemperaturefluctuationsinthesun'sinterior.Accordingtothestandardview,thetemperatureofthesun'scoreisheldconstantbytheopposingpressuresofgravityandnuclearfusion.However,Ehrlichbelievedthatslightvariationsshouldbepossible.

3HetookashisstartingpointtheworkofAttilaGrandpierreoftheKonkolyObservatoryoftheHungarianAcademyofSciences.In2005,Grandpierreandacollaborator,Gáborágoston,calculatedthatmagneticfieldsinthesun'scorecouldproducesmallinstabilitiesinthesolarplasma.Theseinstabilitieswouldinducelocalisedoscillationsintemperature.

4Ehrlich'smodelshowsthatwhilstmostoftheseoscillationscanceleachotherout,somereinforceoneanotherandbecomelong-livedtemperaturevariations.Thefavouredfrequenciesallowthesun'scoretemperaturetooscillatearounditsaveragetemperatureof13.6millionkelvinincycleslastingeither100,000or41,000years.Ehrlichsaysthatrandominteractionswithinthesun'smagneticfieldcouldflipthefluctuationsfromonecyclelengthtotheother.

5ThesetwotimescalesareinstantlyrecognisabletoanyonefamiliarwithEarth'siceages:forthepastmillionyears,iceageshaveoccurredroughlyevery100,000years.Beforethat,theyoccurredroughlyevery41,000years.

6MostscientistsbelievethattheiceagesaretheresultofsubtlechangesinEarth'sorbit,knownastheMilankovitchcycles.OnesuchcycledescribesthewayEarth'sorbitgraduallychangesshapefromacircletoaslightellipseandbackagainroughlyevery100,000years.ThetheorysaysthisalterstheamountofsolarradiationthatEarthreceives,triggeringtheiceages.However,apersistentproblemwiththistheoryhasbeenitsinabilitytoexplainwhytheiceageschangedfrequencyamillionyearsago.

7"InMilankovitch,thereiscertainlynogoodideawhythefrequencyshouldchangefromonetoanother,"saysNeilEdwards,aclimatologistattheOpenUniversityinMiltonKeynes,UK.NoristhetransitionproblemtheonlyonetheMilankovitchtheoryfaces.EhrlichandothercriticsclaimthatthetemperaturevariationscausedbyMilankovitchcyclesaresimplynotbigenoughtodriveiceages.

8However,EdwardsbelievesthesmallchangesinsolarheatingproducedbyMilankovitchcyclesarethenamplifiedbyfeedbackmechanismsonEarth.Forexample,ifseaicebeginstoformbecauseofaslightcooling,carbondioxidethatwouldotherwisehavefounditswayintotheatmosphereaspartofthecarboncycleislockedintotheice.ThatweakensthegreenhouseeffectandEarthgrowsevencolder.

9AccordingtoEdwards,thereisnolackofsuchmechanisms."Ifyouaddtheireffectstogether,thereismorethanenoughfeedbacktomakeMilankovitchwork,"hesays."Theproblemnowisidentifyingwhichmechanismsareatwork."ThisiswhyscientistslikeEdwardsarenotyetreadytogiveuponthecurrenttheory."Milankovitchcyclesgiveusiceagesroughlywhenweobservethemtohappen.Wecancalculatewhereweareinthecycleandcompareitwithobservation,"hesays."Ican'tseeanywayoftesting[Ehrlich's]ideatoseewhereweareinthetemperatureoscillation."

10Ehrlichconcedesthis."Ifthereisawaytotestthistheoryonthesun,Ican'tthinkofonethatispractical,"hesays.That'sbecausevariationover41,000to100,000yearsistoogradualtobeobserved.However,theremaybeawaytotestitinotherstars:reddwarfs.Theircoresaremuchsmallerthanthatofthesun,andsoEhrlichbelievesthattheoscillationperiodscouldbeshortenoughtobeobserved.Hehasyettocalculatethepreciseperiodortheextentofvariationinbrightnesstobeexpected.

11NigelWeiss,asolarphysicistattheUniversityofCambridge,isfarfromconvinced.HedescribesEhrlich'sclaimsas"utterlyimplausible".EhrlichcountersthatWeiss'sopinionisbasedonthestandardsolarmodel,whichfailstotakeintoaccountthemagneticinstabilitiesthatcausethetemperaturefluctuations.

Questions1-4

CompleteeachofthefollowingstatementswithOneorTwonamesofthescientistsfromtheboxbelow.

WritetheappropriatelettersA-Einboxes1-4onyouranswersheet.

A.AttilaGrandpierre

B.Gáborágoston

C.NeilEdwards

D.NigelWeiss

E.RobertEhrlich

1....claimsthereadimmerswitchinsidethesunthatcausesitsbrightnesstoriseandfallinperiodsaslongasthosebetweeniceagesonEarth.

2....calculatedthattheinternalsolarmagneticfieldscouldproduceinstabilitiesinthesolarplasma.

3....holdsthatMilankovitchcyclescaninducechangesinsolarheatingonEarthandthechangesareamplifiedonEarth.

4....doesn'tbelieveinEhrlich'sviewpointsatall.

Questions5-9

Dothefollowingstatementsagreewiththeinformationgiveninthereadingpassage?

Inboxes5-9onyouranswersheetwrite

TRUEifthestatementistrueaccordingtothepassage

FALSEifthestatementisfalseaccordingtothepassage

NOTGIVENiftheinformationisnotgiveninthepassage

5.Theiceageschangedfrequencyfrom100,000to41,000yearsamillionyearsago.

6.ThesoleproblemthattheMilankovitchtheorycannotsolveistoexplainwhytheiceagefrequencyshouldshiftfromonetoanother.

7.Carbondioxidecanbelockedartificiallyintoseaicetoeliminatethegreenhouseeffect.

8.SomescientistsarenotreadytogiveuptheMilankovitchtheorythoughtheyhaven'tfiguredoutwhichmechanismsamplifythechangesinsolarheating.

9.BothEdwardsandEhrlichbelievethatthereisnopracticalwaytotestwhenthesolartemperatureoscillationbeginsandwhenends.

Questions10-14

Completethenotesbelow.

ChooseonesuitablewordfromtheReadingPassageaboveforeachanswer.

Writeyouranswersinboxes10-14onyouranswersheet.

Thestandardviewassumesthattheopposingpressuresofgravityandnuclearfusionsholdthetemperature...10...inthesun'sinterior,buttheslightchangesintheearth's...11...alterthetemperatureontheearthandcauseiceagesevery100,000years.ABritishscientist,however,challengesthisviewbyclaimingthattheinternalsolarmagnetic...12...caninducethetemperatureoscillationsinthesun'sinterior.Thesun'scoretemperatureoscillatesarounditsaveragetemperaturein...13...lastingeither100,000or41,000years.Andthe...14...interactionswithinthesun'smagneticfieldcouldflipthefluctuationsfromonecyclelengthtotheother,whichexplainswhytheiceageschangedfrequencyamillionyearsago.

new weapon to fight cancer

1. British scientists are preparing to launch trials of a radical new way to fight cancer, which kills tumours by infecting them with viruses like the common cold.

2. If successful, virus therapy could eventually form a third pillar alongside radiotherapy and chemotherapy in the standard arsenal against cancer, while avoiding some of the debilitating side-effects.

3. Leonard Seymour, a professor of gene therapy at Oxford University, who has been working on the virus therapy with colleagues in London and the US, will lead the trials later this year. Cancer Research UK said yesterday that it was excited by the potential of Prof Seymour’s pioneering techniques.

4. One of the country’s leading geneticists, Prof Seymour has been working with viruses that kill cancer cells directly, while avoiding harm to healthy tissue. "In principle, you’ve got something which could be many times more effective than regular chemotherapy," he said.

5. Cancer-killing viruses exploit the fact that cancer cells suppress the body’s local immune system. "If a cancer doesn’t do that, the immune system wipes it out. If you can get a virus into a tumour, viruses find them a very good place to be because there’s no immune system to stop them replicating. You can regard it as the cancer’s Achilles’ heel."

6. Only a small amount of the virus needs to get to the cancer. "They replicate, you get a million copies in each cell and the cell bursts and they infect the tumour cells adjacent and repeat the process," said Prof Seymour.

7. Preliminary research on mice shows that the viruses work well on tumours resistant to standard cancer drugs. "It’s an interesting possibility that they may have an advantage in killing drug-resistant tumours, which could be quite different to anything we’ve had before."

8. Researchers have known for some time that viruses can kill tumour cells and some aspects of the work have already been published in scientific journals. American scientists have previously injected viruses directly into tumours but this technique will not work if the cancer is inaccessible or has spread throughout the body.

9. Prof Seymour’s innovative solution is to mask the virus from the body’s immune system, effectively allowing the viruses to do what chemotherapy drugs do - spread through the blood and reach tumours wherever they are. The big hurdle has always been to find a way to deliver viruses to tumours via the bloodstream without the body’s immune system destroying them on the way.

10. "What we’ve done is make chemical modifications to the virus to put a polymer coat around it - it’s a stealth virus when you inject it," he said.

11. After the stealth virus infects the tumour, it replicates, but the copies do not have the chemical modifications. If they escape from the tumour, the copies will be quickly recognised and mopped up by the body’s immune system.

12. The therapy would be especially useful for secondary cancers, called metastases, which sometimes spread around the body after the first tumour appears. "There’s an awful statistic of patients in the west ... with malignant cancers; 75% of them go on to die from metastases," said Prof Seymour.

13. Two viruses are likely to be examined in the first clinical trials: adenovirus, which normally causes a cold-like illness, and vaccinia, which causes cowpox and is also used in the vaccine against smallpox. For safety reasons, both will be disabled to make them less pathogenic in the trial, but Prof Seymour said he eventually hopes to use natural viruses.

14. The first trials will use uncoated adenovirus and vaccinia and will be delivered locally to liver tumours, in order to establish whether the treatment is safe in humans and what dose of virus will be needed. Several more years of trials will be needed, eventually also on the polymer-coated viruses, before the therapy can be considered for use in the NHS. Though the approach will be examined at first for cancers that do not respond to conventional treatments, Prof Seymour hopes that one day it might be applied to all cancers.

Questions 1-6

Do the following statements agree with the information given in the reading passage? For questions 1-6 write

TRUE if the statement agrees with the information

FALSE if the statement contradicts the information

NOT GIVEN if there is no information on this in the passage

1.Virus therapy, if successful, has an advantage in eliminating side-effects.

2.Cancer Research UK is quite hopeful about Professor Seymour’s work on the virus therapy.

3.Virus can kill cancer cells and stop them from growing again.

4.Cancer’s Achilles’ heel refers to the fact that virus may stay safely in a tumor and replicate.

5.To infect the cancer cells, a good deal of viruses should be injected into the tumor.

6.Researches on animals indicate that virus could be used as a new way to treat drug-resistant tumors.

Question 7-9

Based on the reading passage, choose the appropriate letter from A-D for each answer.

7.Information about researches on viruses killing tumor cells can be found

(A) on TV

(B) in magazines

(C) on internet

(D) in newspapers

8.To treat tumors spreading out in body, researchers try to

(A) change the body’ immune system

(B) inject chemotherapy drugs into bloodstream.

(C) increase the amount of injection

(D) disguise the viruses on the way to tumors.

9.When the chemical modified virus in tumor replicates, the copies

(A) will soon escape from the tumor and spread out.

(B) will be wiped out by the body’s immune system.

(C) will be immediately recognized by the researchers.

(D) will eventually stop the tumor from spreading out.

Questions 10-13

Complete the sentences below. Choose your answers from the list of words. You can only use each word once.

NB There are more words in the list than spaces so you will not use them all.

In the first clinical trials, scientists will try to ……10…… adenovirus and vaccinia, so both the viruses will be less pathogenic than the ……11…….These uncoated viruses will be applied directly to certain areas to confirm safety on human beings and the right ……12…… needed. The experiments will firstly be ……13……to the treatment of certain cancers

-----Dad,lookatthebuilding.Itisonfire.

-----Call119____________mobilephonerightnow

A、in
B、by
C、on
D、with
热门试题 更多>
相关题库更多>
听力
阅读
写作
口语
试卷库
试题库